Skip to content

CJC-1295

Growth Signaling Cjc 1295

CJC-1295 is a synthetic 30-amino-acid analogue of human growth hormone-releasing hormone (GHRH) modified with Drug Affinity Complex (DAC) technology. The covalent attachment of a reactive maleimide group enables selective and sustained binding to circulating albumin, extending its half-life and providing prolonged GHRH receptor activation for continuous GH and IGF-1 release.


Chemical Profile

Property Value
CAS Number 863288-34-8
IUPAC Name L-Tyrosyl-L-alanyl-L-α-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-asparaginyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-α-glutaminyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-α-glutaminyl-L-α-aspartyl-L-isoleucyl-L-methionyl-L-seryl-L-arginyl-L-glutamine (with terminal DAC modification)
Amino Acid Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gln-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-OH (C-terminal DAC modification)
Sequence (1-Letter) YADAIFTNSYRKVLGQLSARKLLQDIMSRQ (with DAC)
Molecular Formula C₁₅₂H₂₅₂N₄₄O₄₂ (estimate with DAC)
Molecular Weight ~3315.7 g/mol (with DAC modification)
Purity (HPLC) ≥ 98%

CJC-1295 at a Glance

  • Class: GHRH analogue with DAC technology
  • Developed By: ConjuChem Biotechnologies
  • Research Status: Phase 1/2 clinical trials
  • Route: Subcutaneous
  • Half-life: ~6–8 days (albumin-bound)
  • CAS: 863288-34-8
  • MW: ~3315.7 Da (with DAC)
  • Key Feature: Sustained GH/IGF-1 elevation for 6+ days

Mechanism of Action

CJC-1295 combines a potent GHRH analogue with a reactive maleimide group that covalently binds to cysteine-34 of circulating albumin, creating a long-acting depot.

Primary Signaling Pathways

Component Detail
Primary Target GHRH receptor (pituitary somatotrophs)
Receptor Class Class B GPCR
G-Protein Coupling Gαs → adenylyl cyclase → cAMP → PKA
Albumin Binding Covalent (maleimide-Cys34); half-life ~6–8 days
GH Release Sustained pulse amplification
IGF-1 Elevation ~2- to 3-fold increase sustained for 6+ days

Physiologic Effects

System Effect Mechanism
Pituitary Sustained GH secretion GHRH-R agonism
Hepatic IGF-1 production GH pulse-driven
Muscle Protein synthesis IGF-1 anabolic effect
Bone Bone turnover markers GH/IGF-1
Metabolism Lipolysis GH-mediated

Pharmacology

Parameter Value
Half-life (t½) ~6–8 days (albumin-conjugated)
Bioavailability (SC) ~70–80%
Tmax (GH) ~12–24 hours
IGF-1 Peak ~48–72 hours
Protein Binding > 99% (albumin conjugate)
Metabolism Proteolytic degradation
Route Subcutaneous
Elimination Renal

Research Evidence

Study Model Findings Reference
Teichman et al. 2006 Phase 1, healthy men GH elevation for 6 days; IGF-1 2.5× baseline DOI: 10.1210/jc.2004-2195
Ionescu et al. 2007 Phase 1/2, GH-deficient adults Sustained IGF-1 normalization DOI: 10.1210/jc.2006-2431
Alba et al. 2006 Rat model Dose-dependent GH release over 7 days DOI: 10.1210/en.2005-1623

Dosing Reference

Parameter Recommendation
Research Dose Range 1–2 mg per injection
Dosing Frequency Every 5–8 days
Duration 8–16 weeks
Reconstitution 1–2 mL bacteriostatic water
Storage (Lyophilized) −20°C
Storage (Reconstituted) 2–8°C (7 days)

Safety Profile

Category Observations
Most Common Injection site reactions, transient flushing
Endocrine Sustained GH/IGF-1 elevation
Contraindications Research use only
Immunogenicity Low–moderate (anti-GHRH antibodies in some subjects)

Physicochemical Properties

Property Value
Physical State White lyophilized powder
Solubility (Water) Soluble (> 20 mg/mL)
logP ~ −2.0
pI ~8.5
Stability (Lyophilized) ≥ 24 months at −20°C

Synthesis Pathway (SPPS with DAC Conjugation)

CJC-1295 is a 30-amino-acid GHRH analogue produced by SPPS, followed by post-synthetic conjugation of a Drug Affinity Complex (DAC™) maleimide moiety for covalent albumin binding.

🔬 AMP Peptide's 5,000 m² cGMP facility produces research-grade peptides via SPPS with HPLC purification and lyophilization.

Step Description
1. Resin Loading Fmoc-Gln(Trt)-OH loaded onto Wang resin or HMPB-ChemMatrix (0.2–0.4 mmol/g) for C-terminal carboxylic acid
2. SPPS Assembly Fmoc/tBu strategy; 29 coupling cycles using HATU/HOAt/DIPEA in NMP; double coupling at sterically hindered or β-branched residues (Ile, Val, Thr)
3. Side-Chain Protection Arg(Pbf), Asp(OtBu), Asn(Trt), Gln(Trt), Lys(Boc), Ser(tBu), Thr(tBu), Tyr(tBu)
4. Pseudoproline Dipeptide Use of Fmoc-Ser(ψMe,Mepro)-OH at Ser⁷–Tyr⁸ to improve coupling efficiency in the mid-sequence region
5. Cleavage TFA/TIS/H₂O/DODT (92.5:2.5:2.5:2.5, v/v/v/v), 3 h
6. DAC Conjugation Purified GHRH analogue dissolved in pH 6.5 phosphate buffer; maleimide-PEG₄-MPA-NHS ester (DAC reagent) added at 1.2 equiv; reaction monitored by LC-MS until >95% conversion (typically 2–4 h at 25°C)
7. Purification Preparative RP-HPLC (C18, 20–60% MeCN in 0.1% TFA, 30 min gradient); albumin-binding fractions confirmed by SDS-PAGE shift
8. Lyophilization Freeze-drying yields white amorphous powder; stored under argon

Solid-Phase Support: HMPB-ChemMatrix resin (high-swelling for long peptides).

DAC Reagent: Maleimide-PEG₄-MPA (maleimidopropionic acid-PEG₄) targeting Cys34 of human serum albumin.

Crude Purity: ~55–65% (30-mer); purified yield ~15–25% after DAC conjugation and two HPLC passes.

Identity Confirmation

Method Acceptance Criterion
Amino Acid Analysis All 30 residues within ±10% of theoretical
MALDI-TOF MS [M+H]⁺ ~3316.7 Da (DAC-conjugated); ±0.05% mass accuracy
ES-TOF MS Deconvoluted mass matches theoretical mass of DAC-conjugated peptide
SDS-PAGE Shift from ~3.3 kDa (unconjugated) to ~69 kDa (albumin-bound complex)
SEC-HPLC Monomeric peak at retention time consistent with albumin adduct
Tryptic Mapping LC-MS/MS sequence coverage >95% for the 30-amino-acid backbone

Analytical Methods

HPLC Analysis

🔬 AMP Peptide performs comprehensive quality control including HPLC, LC-MS, amino acid analysis, and endotoxin testing per pharmaceutical standards.

Parameter Condition
Column C18 reverse-phase (4.6 × 250 mm, 5 μm)
Mobile Phase A 0.1% TFA in water
Mobile Phase B 0.1% TFA in acetonitrile
Gradient 20–60% B over 30 min
Flow Rate 1.0 mL/min
Detection UV at 214 nm
Column Temperature 30°C
Injection Volume 20 μL
Retention Time ~16–18 min (DAC-conjugated)

LC-MS Analysis

Parameter Condition
Ionization Electrospray (ESI+), positive mode
Mass Range m/z 600–2000 (wide range for 3.3 kDa peptide)
Capillary Voltage 3.5 kV
Cone Voltage 60 V
Desolvation Temp 400°C
Source Temp 150°C
Detected Mass (M+H)+ ~3316.7 Da
Detected Charge States 3+ (m/z ~1106), 4+ (m/z ~830), 5+ (m/z ~664)

Stability Data

Lyophilized Powder Stability

Condition Duration Purity (HPLC) Appearance
−20°C (long-term) 36 months ≥ 98.0% White powder
2–8°C (refrigerated) 12 months ≥ 96.0% White powder
25°C / 60% RH (accelerated) 3 months ≥ 93.0% Slight caking
40°C / 75% RH (stress) 1 month ≥ 88.0% Yellowing; maleimide hydrolysis
Photostability (ICH Q1B) ≥ 94.0% No significant change

Solution Stability (Reconstituted)

Solvent Concentration Temperature Stability Window
Bacteriostatic water (0.9% BA) 2 mg/mL 2–8°C 7 days
Bacteriostatic water (0.9% BA) 2 mg/mL 25°C 12 hours
PBS (pH 7.4) 1 mg/mL 2–8°C 48 hours
PBS (pH 7.4) 1 mg/mL 37°C 4 hours

Degradation Pathways: The maleimide DAC moiety is susceptible to ring-opening hydrolysis at pH > 7.5, reducing albumin-binding capacity. The GHRH peptide backbone undergoes deamidation at Asn⁸ and Gln¹⁵ under thermal stress. Lyophilized product stored at −20°C with desiccant is recommended for extended stability.


References

  1. Teichman SL, et al. (2006). CJC-1295: Sustained GH release in humans. Journal of Clinical Endocrinology & Metabolism. DOI: 10.1210/jc.2004-2195
  2. Ionescu M, et al. (2007). CJC-1295 in GH deficiency. Journal of Clinical Endocrinology & Metabolism. DOI: 10.1210/jc.2006-2431
  3. Alba M, et al. (2006). CJC-1295 pharmacology in rats. Endocrinology. DOI: 10.1210/en.2005-1623
  4. Pombo M, et al. (2004). GHRH analogue development. Frontiers in Neuroendocrinology. DOI: 10.1016/j.yfrne.2004.05.001
  5. Jaffe CA, et al. (1999). GHRH and GH pharmacology. Endocrine Reviews. DOI: 10.1210/edrv.20.3.0367

Purchase CJC-1295 wholesale from AMP Peptide